Protein Info for Shewana3_1951 in Shewanella sp. ANA-3

Annotation: putative methyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 TIGR00740: tRNA (cmo5U34)-methyltransferase" amino acids 14 to 252 (239 residues), 347.3 bits, see alignment E=2.4e-108 PF01135: PCMT" amino acids 64 to 135 (72 residues), 20.4 bits, see alignment E=1.3e-07 PF01209: Ubie_methyltran" amino acids 64 to 175 (112 residues), 23.7 bits, see alignment E=1e-08 PF13847: Methyltransf_31" amino acids 65 to 176 (112 residues), 34.6 bits, see alignment E=5.4e-12 PF00891: Methyltransf_2" amino acids 66 to 185 (120 residues), 22.4 bits, see alignment E=2.4e-08 PF13649: Methyltransf_25" amino acids 70 to 168 (99 residues), 58.2 bits, see alignment E=3.8e-19 PF08241: Methyltransf_11" amino acids 72 to 172 (101 residues), 45.2 bits, see alignment E=4.4e-15 PF08242: Methyltransf_12" amino acids 72 to 170 (99 residues), 42 bits, see alignment E=4.4e-14

Best Hits

Swiss-Prot: 100% identical to CMOA_SHESA: Carboxy-S-adenosyl-L-methionine synthase (cmoA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to shn:Shewana3_1951)

MetaCyc: 62% identical to carboxy-S-adenosyl-L-methionine synthase (Escherichia coli K-12 substr. MG1655)
RXN0-7066

Predicted SEED Role

"tRNA (uridine-5-oxyacetic acid methyl ester) 34 synthase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWL3 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Shewana3_1951 putative methyltransferase (RefSeq) (Shewanella sp. ANA-3)
MAEFSRYSQMNASQDTIYAQASEHISDFQFDNRVAGVFSDMIRRSVPGYTQIINTIGDFA
DRFVKPNTQVYDLGCSLGAATLSIRRQIQGRDCRIIAVDNSESMVTRCQENLNAYVSDTE
VELICGDIRDIHIENASLVVLNFTLQFLPPEDREALIAKIYHGLNPGGLLVLSEKIRFDD
APIQSVLEELHLDFKRANGYSELEISQKRSALENVMKPDTLTLHQQRLTRQGFSHFSLWF
QCFNFSSMVAIK