Protein Info for Shewana3_1934 in Shewanella sp. ANA-3

Annotation: hemolysin III family channel protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 59 to 83 (25 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details PF03006: HlyIII" amino acids 23 to 219 (197 residues), 127.3 bits, see alignment E=3.6e-41 TIGR01065: channel protein, hemolysin III family" amino acids 26 to 225 (200 residues), 213.2 bits, see alignment E=1.4e-67

Best Hits

Swiss-Prot: 53% identical to YQFA_ECOL6: UPF0073 inner membrane protein YqfA (yqfA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to shn:Shewana3_1934)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWJ6 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Shewana3_1934 hemolysin III family channel protein (RefSeq) (Shewanella sp. ANA-3)
MPSQSLIEPQMSHEKPLNISGYSLSEEIANSISHGLGVIAGVVGLVFMILKGADHLTSIQ
LTGVIIYGASLILLFLSSTLYHSVTHVGWKHKLKIADHCAIYCLIAGTYTPLMLISLQGQ
LSTIILTAIWSLAIGGILFKTLFIHRFKKMSLVLYLVMGWLCVTVMGDLTAAMSPLGFKL
LLLGGLFYTLGVVFYVGKRIPYNHAIWHLFVLAGAMSHFFCIYLTVI