Protein Info for Shewana3_1910 in Shewanella sp. ANA-3

Annotation: alpha/beta hydrolase fold (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 26 to 259 (234 residues), 65.1 bits, E=1.6e-21
• PF12697: Abhydrolase_6
  • amino acids 32 to 264 (233 residues), 47.7 bits, E=6.2e-16
• PF12146: Hydrolase_4
  • amino acids 58 to 254 (197 residues), 30.6 bits, E=4.4e-11
• PF03096: Ndr
  • amino acids 72 to 272 (201 residues), 35.8 bits, E=7.5e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1910)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (2/4 steps found)
• catechol degradation to β-ketoadipate (1/4 steps found)
• catechol degradation III (ortho-cleavage pathway) (1/6 steps found)
• 4-methylcatechol degradation (ortho cleavage) (1/7 steps found)
• superpathway of salicylate degradation (1/7 steps found)
• aromatic compounds degradation via β-ketoadipate (2/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (2/11 steps found)
• mandelate degradation to acetyl-CoA (3/18 steps found)
• superpathway of aerobic toluene degradation (4/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (6/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

See A0KWH2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Shewana3_1910 alpha/beta hydrolase fold (RefSeq) (Shewanella sp. ANA-3)
MDFSSHRKQLNIAGSQLSYLDIGSGPALLFGHSYLWDSAMWAPQIASLSQYYRCIVPELW
GHGQSGAVPESCNSLLDISEHMLTLMDSLNIEQFAVIGLSVGAMWGAELVLKAPARVNAL
VMLDSFIGFEPEITRAKYYGMLDMIQAAGSIPAPLISAISPLFFADNAKANNPELVQRFE
AYLAAQTPETIPSIVKLGRMIFGRRDTMEFAEQLTLPCLVMVGVADKARSVLESYLMSDA
IDGSQLVHIPNAGHISSLEQADFVTEHLTRFLVKVL