Protein Info for Shewana3_1895 in Shewanella sp. ANA-3

Annotation: peptidase T2, asparaginase 2 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01112: Asparaginase_2" amino acids 30 to 339 (310 residues), 385.7 bits, see alignment E=7.9e-120

Best Hits

KEGG orthology group: K13051, beta-aspartyl-peptidase (threonine type) [EC: 3.4.19.5] (inferred from 99% identity to shm:Shewmr7_2140)

Predicted SEED Role

"Isoaspartyl aminopeptidase (EC 3.4.19.5) @ Asp-X dipeptidase" (EC 3.4.19.5)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.19.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWF7 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Shewana3_1895 peptidase T2, asparaginase 2 (RefSeq) (Shewanella sp. ANA-3)
MKIKLATFSLILSSALFMSQNTQANEKPFAIAIHGGAGTISKANLTPELRQAYKDKLKEA
VDKGSKVLEQGGDSLVAVQTAINVLENSPLFNAGVGSVYTYDGGHELDASIMDGKTMNAG
AVAGVRHIANPIDLALAVMNKSEHVMLSGAGAEEFALTQGFKLVPNSHFDSDASYQQLLD
ARQKLQAAEKSDQIAGIEMKDLDYKFGTVGAVALDKNGNLAAGTSTGGMTAKRFGRIGDS
PVIGAGTYAENGVCAVSATGHGEFFIRYQVAGDICAKVKYQQKSIIQAADEVINQRLITA
GGSGGVIAVDHRGNIATPFNTEGMYRATRSNGEPAQVMIWQDQ