Protein Info for Shewana3_1873 in Shewanella sp. ANA-3

Annotation: formate dehydrogenase family accessory protein FdhD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00129: formate dehydrogenase family accessory protein FdhD
  • amino acids 34 to 254 (221 residues), 157.6 bits, E=1.7e-50
• PF02634: FdhD-NarQ
  • amino acids 36 to 259 (224 residues), 196.3 bits, E=3.6e-62

Best Hits

Swiss-Prot: 41% identical to FDHD_PASMU: Sulfur carrier protein FdhD (fdhD) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K02379, FdhD protein (inferred from 100% identity to shn:Shewana3_1873)

Predicted SEED Role

"Formate dehydrogenase chain D (EC 1.2.1.2)" in subsystem Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)
• purine nucleobases degradation II (anaerobic) (11/24 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

See A0KWD5 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Shewana3_1873 formate dehydrogenase family accessory protein FdhD (RefSeq) (Shewanella sp. ANA-3)
MLTHPLDSANDPRLCPESQHSPNAAQHASARYSHLVEEVAAAINLNGISYAVMMITPDHF
EDFVIGFLFAEGIISQDEDVHEIDITPVQDGVMLDVILANRCLIALKQRKRRLVGATGCG
ICGVEALGHALPDLPPLPACAPLVLEHVDCLKQQIHTHQLKAQRSGAIHAAFALDEAGNI
LECREDIGRHNALDKLIGALLRQKRSAKALLMTSRCSSELIQKAVRYGANHLISLASPSQ
LAVKLALKYQLNLVHIPKFDPPIHYSIFDESLACQCNSGEFYACSY