Protein Info for Shewana3_1836 in Shewanella sp. ANA-3

Annotation: LysR family transcriptional regulator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 PF00126: HTH_1" amino acids 10 to 62 (53 residues), 70.3 bits, see alignment 1.1e-23 PF03466: LysR_substrate" amino acids 88 to 288 (201 residues), 142.8 bits, see alignment E=1e-45

Best Hits

Swiss-Prot: 30% identical to YCAN_ECOLI: Uncharacterized HTH-type transcriptional regulator YcaN (ycaN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1836)

Predicted SEED Role

"Transcriptional regulator, LysR family, in formaldehyde detoxification operon" in subsystem Glutathione-dependent pathway of formaldehyde detoxification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KWA0 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Shewana3_1836 LysR family transcriptional regulator (RefSeq) (Shewanella sp. ANA-3)
MYLWDGISEFVAVAEVENFTLAALRLNVSTAHVSRQIGALENRLGTKLFYRTTRKVSLTE
EGTIYYRHCRQLQTGLEEAERAITDLKGSPQGLVKLTAPVAYGEKFIMPLLNDFMVQYPS
VEFNVDLTNRTLDLIEGGYDLAIRLGKLADSSLMAKPLSSRTHYVAASPSYVEKYGEPHT
LSELNQHNCLIGNHNYWRFIENGRERNIKVRGNLICNSGYALRDAALKGIGIVQLPDYYI
EEDIHAGRLISFLDAHREAKEGIWALYPQNRHLSAKVRVLVDYLAEKLAMEDA