Protein Info for Shewana3_1769 in Shewanella sp. ANA-3

Annotation: TatD family hydrolase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR00010: hydrolase, TatD family" amino acids 6 to 258 (253 residues), 296.7 bits, see alignment E=6.7e-93 PF01026: TatD_DNase" amino acids 7 to 258 (252 residues), 279.1 bits, see alignment E=1.7e-87

Best Hits

Swiss-Prot: 56% identical to YCFH_ECOL6: Uncharacterized metal-dependent hydrolase YcfH (ycfH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03424, TatD DNase family protein [EC: 3.1.21.-] (inferred from 99% identity to shm:Shewmr7_1739)

Predicted SEED Role

"Putative deoxyribonuclease YcfH" in subsystem YcfH

Isozymes

Compare fitness of predicted isozymes for: 3.1.21.-

Use Curated BLAST to search for 3.1.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KW33 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Shewana3_1769 TatD family hydrolase (RefSeq) (Shewanella sp. ANA-3)
MEIAVLIDSHCHLDRLKAAPDQQTLELILANAKARGVDYMLCVNVRQQGFESMRDKVAAF
EQVFLSSGVHPLDVKDGLDVEQIRRFAMDPKVVAIGETGLDYFYADETKALQQQCFEQQI
ALAVEVNKPLIVHTRDAREDTINMLKAGQADKVGGVLHCFTENWEMAKAAIDLGFYISVS
GIVTFKNAGELRTVIRKVPKERLLVETDSPYLAPIPHRGQENQPAYVRDVAEFVAELRGE
RYEELAEYTSENFFNLFKDAARLIGR