Protein Info for Shewana3_1759 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 290 to 313 (24 residues), see Phobius details PF03547: Mem_trans" amino acids 17 to 307 (291 residues), 77.5 bits, see alignment E=3.8e-26

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 99% identity to shm:Shewmr7_1729)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KW23 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Shewana3_1759 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MGNIIEQLLFSASITGPICLMLALGVMLKRTQVIDEHFIDVASKLVFNVTLPALLFLSII
SSHHDLAASAPLIGYGLLANLLFFILSTYATKRFFPEPKDQGVIIQGGFRANTAIIGLAY
VSNAYGESGVALAAVYVASMTLLYNIQAVICLSPRGEESSRRAFAVIIKTITKNPLIIAI
MLGMLFYLLAIPVPKMVLDAGQYFANMTLPLALLCTGGSLDIGSLRHEKYSTWFSTALKL
VFAPLFITLGALILGYRGVELALVFLMSAAPTAAASYVMARAMGGNATLAANIIALTTVC
SLLTCTLGIFILSTLGLI