Protein Info for Shewana3_1753 in Shewanella sp. ANA-3

Annotation: ATP-dependent Clp protease, ATP-binding subunit clpA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 755 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 735 (733 residues), 1088.8 bits, see alignment E=0 PF02861: Clp_N" amino acids 13 to 62 (50 residues), 52.4 bits, see alignment 3.1e-17 PF00004: AAA" amino acids 212 to 317 (106 residues), 46.7 bits, see alignment E=2.9e-15 amino acids 493 to 608 (116 residues), 38.7 bits, see alignment E=8.6e-13 PF17871: AAA_lid_9" amino acids 351 to 452 (102 residues), 92.2 bits, see alignment E=1.2e-29 PF07724: AAA_2" amino acids 487 to 648 (162 residues), 201.5 bits, see alignment E=6.2e-63 PF00158: Sigma54_activat" amino acids 491 to 616 (126 residues), 22.5 bits, see alignment E=5.1e-08 PF07728: AAA_5" amino acids 492 to 608 (117 residues), 44.6 bits, see alignment E=9.9e-15 PF10431: ClpB_D2-small" amino acids 654 to 733 (80 residues), 82.1 bits, see alignment E=1.6e-26

Best Hits

Swiss-Prot: 70% identical to CLPA_ECOLI: ATP-dependent Clp protease ATP-binding subunit ClpA (clpA) from Escherichia coli (strain K12)

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 100% identity to shn:Shewana3_1753)

MetaCyc: 70% identical to ATP-dependent Clp protease ATP-binding subunit ClpA (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KW17 at UniProt or InterPro

Protein Sequence (755 amino acids)

>Shewana3_1753 ATP-dependent Clp protease, ATP-binding subunit clpA (RefSeq) (Shewanella sp. ANA-3)
MLNKDLEVTLNLAFQQAREARHEYMTVEHLLLALIDNPAAQEALIACGANLDKLRDEVAS
FIQQTTPIIADMDDDKETQPTLGFQRVLQRAVFHVQSSGRNEVTGANVLVAIFSEQESQA
VYLLRRSDISRLDVVNYISHGFSKNEDSDAHQDHERIEDQAEAGEERSMLSQFASNLNQL
AKQGIIDPLIGRDQEIERAIQTLCRRRKNNPLLVGEAGVGKTAIAEGLAYRIVNNQVPEV
MSQATVYSLDLGSLLAGTKYRGDFEKRFKSLLKELSADKHAILFIDEIHTIIGAGAASGG
VMDASNLLKPLLSSGNLRCMGSTTFQEYQSIFEKDRALARRFQKVDINEPSVAETTKILM
GLKAKYEEYHGVRYTQAAINSAAELSAKHINDRHLPDKAIDVIDEAGARMAMLPQSKRKK
TIGQAEIETIVAKIARIPEKSVSATDKDLLRNLERNLKMVVFGQDKAIESLSSAIRLSRS
GLGTDKKPVGSFLFAGPTGVGKTEVTNQLASCLGMKLVRFDMSEYMESHTVSRLIGAPPG
YVGYDQGGLLTDAVIKNPHCVVLLDEIEKAHPDVYNLLLQVMDHGTLTDNNGRKADFRHV
TLVMTTNAGVQETIRKSIGFTQQDHTQDALSEINRVFSPEFRNRLDSIIWFNHLDMTIIA
KVVDKFLVELQAQLDAKHVVLEVSDEARTLLAEKGYDKSMGARPMARVVTELIKRPLADE
ILFGELEHGGIAHVDAKEGEIVIHTERHEKSTSKA