Protein Info for Shewana3_1752 in Shewanella sp. ANA-3

Name: clpS
Annotation: ATP-dependent Clp protease adaptor protein ClpS (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 PF02617: ClpS" amino acids 20 to 98 (79 residues), 121.1 bits, see alignment E=6.8e-40

Best Hits

Swiss-Prot: 100% identical to CLPS_SHESA: ATP-dependent Clp protease adapter protein ClpS (clpS) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K06891, ATP-dependent Clp protease adaptor protein ClpS (inferred from 98% identity to spc:Sputcn32_2228)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KW16 at UniProt or InterPro

Protein Sequence (102 amino acids)

>Shewana3_1752 ATP-dependent Clp protease adaptor protein ClpS (RefSeq) (Shewanella sp. ANA-3)
MGKTGNIEHVEERVESELMPPSMYKVILNNDDYTPMDFVIEVLQIFFRKNEQEATDIMLT
IHHQGKGICGIFPYGIAETKVIQVNQFARQNQHPLLCSLEKA