Protein Info for Shewana3_1747 in Shewanella sp. ANA-3

Name: mnmA
Annotation: tRNA-specific 2-thiouridylase MnmA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF02568: ThiI" amino acids 10 to 80 (71 residues), 31.1 bits, see alignment E=5.3e-11 PF02540: NAD_synthase" amino acids 10 to 80 (71 residues), 33 bits, see alignment E=1.1e-11 PF03054: tRNA_Me_trans" amino acids 11 to 208 (198 residues), 281.7 bits, see alignment E=1e-87 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 11 to 366 (356 residues), 503.4 bits, see alignment E=1.4e-155 PF20259: tRNA_Me_trans_M" amino acids 214 to 281 (68 residues), 75.4 bits, see alignment E=6.3e-25 PF20258: tRNA_Me_trans_C" amino acids 291 to 366 (76 residues), 88.2 bits, see alignment E=1.1e-28

Best Hits

Swiss-Prot: 100% identical to MNMA_SHESA: tRNA-specific 2-thiouridylase MnmA (mnmA) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 100% identity to she:Shewmr4_1603)

MetaCyc: 76% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KW11 at UniProt or InterPro

Protein Sequence (372 amino acids)

>Shewana3_1747 tRNA-specific 2-thiouridylase MnmA (RefSeq) (Shewanella sp. ANA-3)
MTSIEPTHTGKKVIVGMSGGVDSSVSAYLLMQQGYQVEGLFMKNWEEDDNDEYCAAAEDL
KDAQAVCDKLGIKLHTVNFAAEYWDNVFEYFLAEYKAGRTPNPDIMCNKEIKFKAFLDFA
DDILDADYIAMGHYVRRRDNADGTTQMLRGVDNNKDQSYFLYTLSHEQVARSLFPVGELE
KHEVREIAKKMGLITHDKKDSTGICFIGERKFTEFLGNYLPAQPGNIETAEGEIIGKHQG
LMYQTLGQRKGLGIGGMKNSNDDPWYVVDKDLKRNVLVVGQGGHHPRLMSNGMLVNQLHW
VDRKGPAEGSQIVVKTRYRQQDIPCTLTYLDDNTLKVVFDEPVAAVTPGQSAVFYDGEVC
LGGGIIDQLIRG