Protein Info for Shewana3_1723 in Shewanella sp. ANA-3

Annotation: ATPase domain-containing protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details PF26769: HAMP_PhoQ" amino acids 192 to 235 (44 residues), 45 bits, see alignment 8.3e-16 PF02518: HATPase_c" amino acids 347 to 448 (102 residues), 62.7 bits, see alignment E=4.3e-21

Best Hits

KEGG orthology group: K07637, two-component system, OmpR family, sensor histidine kinase PhoQ [EC: 2.7.13.3] (inferred from 100% identity to shn:Shewana3_1723)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVY7 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Shewana3_1723 ATPase domain-containing protein (RefSeq) (Shewanella sp. ANA-3)
MQLRLKMKKRLLTRMFLTSLSIITLVGFGLAWMVNILHAQNSYNEETAQLIAEIPQVAAE
LREHDLIPDTSAWLEENNKQERYVMASCDEKFKQVWTSSLAVDRGLFDTCERFNEIRNDS
PPYYLTMADDRGYFVYLLAVEIAGVHYNLLVMKDAAKLEQEYSKFSKRTYIRLAMVLALA
LILLVSAAYWGMRPLVRMQNELQSINQGKTKSLSEGYPVELEGVTQALNQLLQQSSAQQQ
RYQNAMNDLAHSLKTRLAAVHAITDDTSLSKQSANEKIMEQISQMDQLVKYQLKRAMLGR
QGLKQEHTAIAPLVDQLAQMLFKIYREKQVQFKANIPTNLQFPGNKGDLMELCGNLMENA
FRLCISQVQVSARYTDQGDFELIVEDDGPGVEEKLRQKIIQRGVRADTQSPGQGIGLAVC
DEIVSSYGGELSIEESHLEGARFRIRIPV