Protein Info for Shewana3_1678 in Shewanella sp. ANA-3

Annotation: peptidase S8 and S53, subtilisin, kexin, sedolisin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 705 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF17963: Big_9" amino acids 33 to 120 (88 residues), 24.7 bits, see alignment E=5.6e-09 PF00082: Peptidase_S8" amino acids 165 to 525 (361 residues), 144.6 bits, see alignment E=6.1e-46 PF01483: P_proprotein" amino acids 582 to 665 (84 residues), 43 bits, see alignment E=6.1e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1678)

Predicted SEED Role

"Extracellular serine protease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVU2 at UniProt or InterPro

Protein Sequence (705 amino acids)

>Shewana3_1678 peptidase S8 and S53, subtilisin, kexin, sedolisin (RefSeq) (Shewanella sp. ANA-3)
MRMSIVALSITAALLAGCGSDDKKAPAPVPKVNTAPTTADMTVDVSQSMLFTGKLEASDA
EGGLTYSLVDPADLKLGTFTLVNKNTGEFTYASDASEGTEVVRFKVSDGQLQAEANLTIN
IKHGDPLFTYQWHLKNTGQNAFAAHRGVAGEDMNVSGAISDNAMGQGITVAVVDDGLEIA
HPDLMNNTVNGGSYNLITGTVDPTPFSGESGHGTAVGGIIAAEGWNGIGGRGVAPKAKLI
GFNFLDQDPTGKVENVQTFENFAKSHGASAYSDSARVFNQSYGYSVPFPHGFDEDETEVY
QDIATQSFDGKGSIFVKSAGNGYNYYRYRTFWLPGDYFTATAEKPANHGLPFHNSNMSSD
NANVYNLVVSAINAKGELSSYSSVGSNIFVTAPGGEYGDDDPAIVTTDRMGCENGSAIAE
DRPSTPFHGGLNPLNPNCDYTSTMNGTSSAAPNTSGAVAVIMSANPDLSWRDVRYILAKT
ATKVDADIAPKTVTIGEGEAAPVYTAIPGWLQNAAGFSFHNLYGFGRVDLTEAVKLAKSY
AEDLGDYVVTEWQASPELTKAIPDADVNGVTDTQVVADDLVIEAVQIELTADHLRLPDLA
VELISPSGTKSVLMTPYNGLVYQGVMDKTDPDDLVTGYDATPMLSNAFYGESSKGEWTIK
LIDVNSGSYRFVKYDQGYISIPNEADGKLKGWSIRFHGHAAKSAS