Protein Info for Shewana3_1676 in Shewanella sp. ANA-3
Annotation: small multidrug resistance protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to GDX_ECOL6: Guanidinium exporter (gdx) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K11741, quaternary ammonium compound-resistance protein SugE (inferred from 98% identity to she:Shewmr4_1608)MetaCyc: 62% identical to guanidinium exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-368; TRANS-RXN-369
Predicted SEED Role
"Quaternary ammonium compound-resistance protein SugE"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KVU0 at UniProt or InterPro
Protein Sequence (104 amino acids)
>Shewana3_1676 small multidrug resistance protein (RefSeq) (Shewanella sp. ANA-3) MSWFLLILAGLFEIGWAIGLKYTDGFSRLWPSVFTVFSMTVSVLLLGLAVKQLPIGTAYG VWVGIGAMGTAIAGIILLGEGVSLLKIASLILILLGVLGLKLAH