Protein Info for Shewana3_1670 in Shewanella sp. ANA-3

Annotation: methylglutaconyl-CoA hydratase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF00378: ECH_1" amino acids 30 to 277 (248 residues), 149.2 bits, see alignment E=1.4e-47 PF16113: ECH_2" amino acids 34 to 256 (223 residues), 101.4 bits, see alignment E=7.7e-33

Best Hits

KEGG orthology group: K13766, methylglutaconyl-CoA hydratase [EC: 4.2.1.18] (inferred from 100% identity to shn:Shewana3_1670)

Predicted SEED Role

"Methylglutaconyl-CoA hydratase (EC 4.2.1.18)" in subsystem Benzoate transport and degradation cluster or HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism (EC 4.2.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVT4 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Shewana3_1670 methylglutaconyl-CoA hydratase (RefSeq) (Shewanella sp. ANA-3)
MTGIIMTDTQHQNTSTQSLANLQHVSYALNNGVGELILNRAEVHNAFDEVMISEMIAVLG
YFAEHKDCKLLVLKANGKNFSAGADLNWMRKQAKMDFEQNLNDAKALAKLMQDLDTFPKP
TIALVQGAAFGGALGLICASDIAIATERASFCLSEVKLGLIPAVISPYVARAMGNRASRR
YMLTAERFDAQTALKLNVIHEINDDLAAAAQPIITALQANSPQGMAWVKTLLARLEDGVI
DQDTIDYTSERIARIRVSDEGQEGLNAFFEKRQPNWHTPTDTQGVL