Protein Info for Shewana3_1662 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 54 (27 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 140 to 168 (29 residues), see Phobius details amino acids 182 to 199 (18 residues), see Phobius details amino acids 206 to 226 (21 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details PF01925: TauE" amino acids 6 to 246 (241 residues), 120.4 bits, see alignment E=5.2e-39

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to shn:Shewana3_1662)

Predicted SEED Role

"Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVS6 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Shewana3_1662 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MDWLLIALAGLLGGMLNAVAGGGSFITLFALVFVGVPPLMANATGTAALLPGYLASAWRF
RKEIEYPANLNLKTLCLIAIAGGCLGAAILLSTSEQVFAYLVPWLILLATLAFIAGPWLL
KKRLANASIPRVNTVKPLTVMMILFIVCIYGGYFNGGLGIILLATFGLLGQTQLHGMNGL
KNLLSALLTTIAVVIYALGNLIDGQYLLLLAIMAIIGGYLGAALAYRIPQSLLRGFIVLV
GFAMSVGFFMR