Protein Info for Shewana3_1660 in Shewanella sp. ANA-3

Annotation: GCN5-related N-acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 46 to 67 (22 residues), see Phobius details PF13673: Acetyltransf_10" amino acids 29 to 134 (106 residues), 39.5 bits, see alignment E=8.3e-14 PF00583: Acetyltransf_1" amino acids 35 to 130 (96 residues), 54.6 bits, see alignment E=2e-18 PF13508: Acetyltransf_7" amino acids 44 to 132 (89 residues), 45.7 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1660)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVS4 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Shewana3_1660 GCN5-related N-acetyltransferase (RefSeq) (Shewanella sp. ANA-3)
MAAISIRQAQIADLNAMANLLLQLGYSASEAQLQQYLDDPKRSDEIYLAESEGVVVGLIS
LIFFDYFPSQQQICRITALVVAEASRGLGVGTQLIDLAKGRASELGCRQLEVTTSMRREQ
TQAYYEAIGFEKTSFRYIQAIEGK