Protein Info for Shewana3_1655 in Shewanella sp. ANA-3

Annotation: glycine cleavage system transcriptional repressor, putative (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF13740: ACT_6" amino acids 4 to 78 (75 residues), 84.7 bits, see alignment E=3.2e-28

Best Hits

KEGG orthology group: K03567, glycine cleavage system transcriptional repressor (inferred from 97% identity to shw:Sputw3181_2324)

Predicted SEED Role

"Glycine cleavage system transcriptional antiactivator GcvR" in subsystem Glycine cleavage system or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVR9 at UniProt or InterPro

Protein Sequence (183 amino acids)

>Shewana3_1655 glycine cleavage system transcriptional repressor, putative (RefSeq) (Shewanella sp. ANA-3)
MTNFLVVTAMGVDRPGLVSKLARLASDCDCDIVDSRMALFGNEFTLIMMLSGSWASITKI
ESLLPSLSVELELMTVMKRTSKHTPQNYLSRLEVRFTGKDQRGTMKLITQFLADRSLDLA
AVRSFSEELDNGEQTQTISLTINIPEKVELEKLEKSIYQLSEEMALDCTIRRMEGTTSRS
DRG