Protein Info for Shewana3_1651 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 20 to 52 (33 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 218 to 239 (22 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 308 to 335 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 22 to 347 (326 residues), 243.4 bits, see alignment E=2.1e-76

Best Hits

KEGG orthology group: K03548, putative permease (inferred from 100% identity to shn:Shewana3_1651)

Predicted SEED Role

"Putative permease PerM (= YfgO)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVR5 at UniProt or InterPro

Protein Sequence (366 amino acids)

>Shewana3_1651 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MFSFFSRWYQERFSDPQAVTLLAILVGLALVLYFAGGLLAPLLVALVLAFLLEWPVAQML
KLGINRTTGASLVLVLFLGIVVLLTFGLIPSVWRQGVSLMTDLPSMIDKGLQTLQGLATQ
YPQFVSSEQLNLMVAELKKLLDTQHLLDIAKQLIGYSASLLVLMVYAILVPLLVFFFLKD
KDQLISGSKRFFPTNRQLARKVWFEMHQQIFNYIRGKVIEIVIVGVASYIFFAFMGLRYS
ALLGVLTGLSVLIPYVGATLVTLPIMLVAFFQWGFSSEFGYLMLGYGIIQALDGNVLVPI
LFSDAVDLHPVIIIAAVLVFGGLWGVWGVFFAIPLASLVKAVINAWPKTEIEPVAITQVK
ADSAEA