Protein Info for Shewana3_1634 in Shewanella sp. ANA-3

Name: nhaB
Annotation: sodium/proton antiporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 129 to 146 (18 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 209 to 226 (18 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 307 to 337 (31 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details amino acids 396 to 420 (25 residues), see Phobius details amino acids 459 to 478 (20 residues), see Phobius details amino acids 485 to 504 (20 residues), see Phobius details PF06450: NhaB" amino acids 1 to 520 (520 residues), 1007.9 bits, see alignment E=1.1e-307 TIGR00774: Na+/H+ antiporter NhaB" amino acids 1 to 520 (520 residues), 894.4 bits, see alignment E=1.5e-273 PF03600: CitMHS" amino acids 71 to 349 (279 residues), 69 bits, see alignment E=4e-23

Best Hits

Swiss-Prot: 100% identical to NHAB_SHESA: Na(+)/H(+) antiporter NhaB (nhaB) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03314, Na+:H+ antiporter, NhaB family (inferred from 100% identity to shn:Shewana3_1634)

Predicted SEED Role

"Na+/H+ antiporter NhaB" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVP8 at UniProt or InterPro

Protein Sequence (533 amino acids)

>Shewana3_1634 sodium/proton antiporter (RefSeq) (Shewanella sp. ANA-3)
MPMTMSQAFIGNFLGNSPKWYKIAILSFLIINPILFFYVSPFVAGWVLVLEFIFTLAMAL
KCYPLQPGGLLAIEAVAIGMTSASQVLHEIEANLEVLLLLVFMVAGIYFMKQLLLFVFTK
MITKVRSKILVSLLFCLASAFLSAFLDALTVIAVIITVAVGFYSIYHKVASGKDFSADHD
HTSEGKNDDGENQLNEDELESFRGFLRNLLMHAGVGTALGGVCTMVGEPQNLIIAAQANW
QFGEFAIRMSPVTVPVLFAGILTCFIVEKFRWFGYGAQLPDAVHKILCDYAAYEDARRTN
KDKMKLVIQAFVGVWLIAGLALHLASVGLIGLSVIILTTAFNGITDEHALGKAFEEALPF
TALLAVFFAVVAVIIDQQLFGPVIQWALNHEGNTQLVIFYIANGLLSMVSDNVFVGTVYI
NEVKAALINGQITRDQFDLLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLSYGR
MVWMALPYTIVLSIVGVMAIQSGFLEQMTQYFYDSHAILHHSVKEALAPAAAH