Protein Info for Shewana3_1608 in Shewanella sp. ANA-3
Annotation: response regulator (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to UVRY_ECO57: Response regulator UvrY (uvrY) from Escherichia coli O157:H7
KEGG orthology group: K07689, two-component system, NarL family, invasion response regulator UvrY (inferred from 100% identity to son:SO_1860)Predicted SEED Role
"BarA-associated response regulator UvrY (= GacA = SirA)" in subsystem Pseudomonas quinolone signal PQS or Quorum sensing regulation in Pseudomonas or Type III secretion system orphans
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KVM3 at UniProt or InterPro
Protein Sequence (214 amino acids)
>Shewana3_1608 response regulator (RefSeq) (Shewanella sp. ANA-3) MISIYLVDDHELVRTGIRRILEDERGIKVVGEAPDGETAVQWARQNEADVILMDMNMPGM GGLEATRKILRYQPHAKIIVLTVHTEDPFPSKVMQAGASGYLTKGATPPEVLQAIRQVSR GQRYLSPEIAQQMALSQFNPADENPFKALSERELQIMLMITNGEKVNDISEQLNLSPKTV NSYRYRLFAKLGISGDVELTRLAIRYKMLDAGHF