Protein Info for Shewana3_1603 in Shewanella sp. ANA-3

Annotation: ABC transporter ATPase component (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 640 PF00005: ABC_tran" amino acids 19 to 188 (170 residues), 93.1 bits, see alignment E=1.6e-29 amino acids 338 to 472 (135 residues), 93.5 bits, see alignment E=1.3e-29 PF12848: ABC_tran_Xtn" amino acids 227 to 303 (77 residues), 32.2 bits, see alignment E=6.7e-11 PF16326: ABC_tran_CTD" amino acids 569 to 637 (69 residues), 71.1 bits, see alignment E=5e-23

Best Hits

Swiss-Prot: 60% identical to UUP1_HAEIN: ABC transporter ATP-binding protein uup-1 (uup-A) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1603)

Predicted SEED Role

"ABC transporter ATP-binding protein uup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVL8 at UniProt or InterPro

Protein Sequence (640 amino acids)

>Shewana3_1603 ABC transporter ATPase component (RefSeq) (Shewanella sp. ANA-3)
MSLVRINNGSLAYGYTPLLQNADFTIERGERVCIVGRNGAGKSSLLKILSGDVLLDEGEF
NIDGSVTVSRLQQDPPKAEQGSVYSYIAAGLKEVGEALEQYHQLSHDVAYAEPELMERML
NQMQKLQETLDHHNGWQLDSRIKQNCELLGLDPDKSLSELSGGWQRKVALARALVSEPDL
LLLDEPTNHLDIDTIEWLEKFLLDFQGAIVFISHDRGFIARMATRIVDLDRGVVTSWPGN
YQAYLDGKQEWLRVEAEKNALFDKRLAEEEVWIRQGVKARRTRNEGRVRALKALRQERSE
RLNRQGNAKMAVADTERSGKLVFDVKDLNYNLPDKNLVKNFNTTVLRGDRIALIGPNGCG
KSTLIKLLIEKLQPQSGEVKVGTKLEIAYFDQYREALDPEQTVEDNVGEGKKTITINGQD
RHILSYLQDFLFSPMRARTPVKALSGGEKNRLLLAKLLIRPANLIILDEPTNDLDIETLE
LLESLLTEYQGTLLLVSHDRAFIDNTVTSSWWYAGNGHWSEYVGGYQDAIDQGAKFYSEE
PSQPNTVEAPATVKTAEVKVAEPAKAAKKLSYKLQRELEAMPELMETLEAEILELQTTVA
SPDFYSQTQDKINSVLNLLADKEKQLEVCFERWEELESLK