Protein Info for Shewana3_1593 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 43 to 68 (26 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 242 to 262 (21 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details PF14351: DUF4401" amino acids 42 to 359 (318 residues), 119.7 bits, see alignment E=9e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1593)

Predicted SEED Role

"FIG01065933: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVK8 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Shewana3_1593 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MNKHPNESLQTSGVSEVQTLWQSLYAKGAVNTPELPESQDMPWYIALMQAGAAWIAAWFL
LGFMVSLFDSLWGRFEGGTALFIGGSYLGLGLALYWGGRQQHFLQQFAFASCLSGTLALA
WGLFDLLGEAFNLAWYLSMAALFFLLWGIIKHAVAQWVFAFGCSVCVTGLLAEWHLLSFT
PTLWLLLSSIMLLNLHRTGHHYQRARMWIFATSANLLTIQLMHVFSLDSEFSQLYAVDWQ
SGITAVHLLVVFAICSFLLLSLCKQWQTPFTHPAILFAFLGLVLITALSFPMEGLSTAVL
LILLGHYGHEAWLKGMGIASGLVFAAGYYYSLETTLMLKSLYLMGLGGVLIIARLLMWRF
FPITQVQVEHKEQA