Protein Info for Shewana3_1592 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 45 to 64 (20 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 145 to 171 (27 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 250 to 271 (22 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details PF09925: DUF2157" amino acids 10 to 166 (157 residues), 112.7 bits, see alignment E=6.3e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1592)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVK7 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Shewana3_1592 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MRHLTSHVYEWLEQGHITPTEANELYRQLSVPPNAASWRSLLAQLLQWAGALSFACGVIF
FFAYNWQSLARMSKFALIEAALLISLVSFVWLYYHSAAKQLVDPSHCLFGATLANAALLV
VSMLVGGLLALVGQTYQTGADPWQLFAIWALAILPFAWVAGFDGLWLLLVGLVNLSLGLY
ADTTLLWLDEQLWLCLFVVLNLTIYYGFVFLGSTSRRWHAPFVEYASSLTAMGCFTLLVC
WMIFEPSDTKPLLVAVWVGYFGHLLFGFWWFRHKRLQVYPLALGGFSLISVGAALFTELL
FRNSDPIGGFLLIGLYIILASTGLSTVLRRLHRQAKAGISPTQTPSENEELSHE