Protein Info for Shewana3_1579 in Shewanella sp. ANA-3

Annotation: alcohol dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 120 to 139 (20 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details PF16884: ADH_N_2" amino acids 5 to 109 (105 residues), 134.6 bits, see alignment E=1.9e-43 PF00107: ADH_zinc_N" amino acids 156 to 290 (135 residues), 97.2 bits, see alignment E=1.1e-31 PF13602: ADH_zinc_N_2" amino acids 188 to 329 (142 residues), 62.6 bits, see alignment E=1.1e-20

Best Hits

Swiss-Prot: 43% identical to DBR_TOBAC: 2-alkenal reductase (NADP(+)-dependent) (DBR) from Nicotiana tabacum

KEGG orthology group: K07119, (no description) (inferred from 100% identity to shn:Shewana3_1579)

Predicted SEED Role

"Putative oxidoreductase YncB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVJ4 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Shewana3_1579 alcohol dehydrogenase (RefSeq) (Shewanella sp. ANA-3)
MISSQIHLASRPVGMPTLANFKQVEVTLPALKAGEVLVKNTWMSVDPYMRGRMMDRDSYI
PPFQIDAVMDGGAIGEVIESLNPQFPVGSKVSHISGWRSAFISDGQDLTLLPAVNIPEQY
FLGVIGMPGLTAWVGLMQIAKLKPTDTVFVSAASGAVGMVVCQIAKLNGCKVIASVGSDE
KAELVQSLGVDAVINYKKVTDLTQALRDAAPNGIDVYFENVGGAHLEAALNVLNEYGRIP
VCGMIADYNAQAPVSGPSNLLAINTKKLTMQGFIVMDYFDQFEEFIAQMAQWLQAGKVKS
QETVYHGLDQAAEAFIGLFEGKNKGKMLVKL