Protein Info for Shewana3_1576 in Shewanella sp. ANA-3

Annotation: cyclic nucleotide-binding protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 PF00027: cNMP_binding" amino acids 52 to 118 (67 residues), 37.7 bits, see alignment E=3.3e-13 PF00571: CBS" amino acids 153 to 205 (53 residues), 44.8 bits, see alignment 2.7e-15 amino acids 218 to 272 (55 residues), 44.2 bits, see alignment 4.1e-15 PF03445: DUF294" amino acids 300 to 436 (137 residues), 160.5 bits, see alignment E=4.7e-51 PF10335: DUF294_C" amino acids 473 to 616 (144 residues), 144.4 bits, see alignment E=4.5e-46

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 100% identity to shn:Shewana3_1576)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVJ1 at UniProt or InterPro

Protein Sequence (620 amino acids)

>Shewana3_1576 cyclic nucleotide-binding protein (RefSeq) (Shewanella sp. ANA-3)
MNASELQPVVQFLTSTAPFDTLPNETILRCAKSVTVGYYSKASGFVKFDADAPKLYLVRS
GAFEVRDPEGVLVDRVAEGEFFGFSTLLSGEKVVNRVAILEDSLVYHLPQALFDQLRSES
RHFDKFFTRAFAKRLRHEARFKAKDLTTTSRISTLMSSSPIMIDAHASVTQAALLMRNSR
VSSLLVTDNHKLVGILTDKDLRNRVLAAGLDGRIAVHQAMTTSPISISSNALIFEAMLLM
SEHNIHHLPIIDEQNTEEVKAIGMVTSTDILRGQGSQPLLLIGEIERQRDLASLISVSKQ
IPLLLQNLISADARAEEIGRVLTSVTDALTRRLIVLNQQILGEAPMAFCWLAFGSQGRQD
QAACSDQDNGLLVAEEMDDYAKGYFDALTHAVCAGLDQCGYAFCPGNIMAQNPLWRMSLN
EWQQVFEKWVVTPEPKALMHASIFFDMRSVFGPQSLFDALQDKVLAQTKDNDIFLAGMTG
NSLVESPPLGFFRKFVLERDGSEVKGIDLKHKGNALINDIARVYALSAGIKEVNTAKRIR
ALMDANILNRKDALNLADAHEFIAHMRLSNQGYQHTQGLKISNYLLPGHLSSLVRHQLRD
AFKVVHDAQSGMKMKFMRSF