Protein Info for Shewana3_1575 in Shewanella sp. ANA-3

Annotation: Na+/solute symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 249 to 274 (26 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 387 to 414 (28 residues), see Phobius details amino acids 435 to 453 (19 residues), see Phobius details amino acids 459 to 482 (24 residues), see Phobius details amino acids 492 to 513 (22 residues), see Phobius details amino acids 533 to 554 (22 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 7 to 569 (563 residues), 864.9 bits, see alignment E=1.1e-264 PF00474: SSF" amino acids 33 to 299 (267 residues), 115.7 bits, see alignment E=1.3e-37 amino acids 383 to 500 (118 residues), 54.6 bits, see alignment E=4.4e-19

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 100% identity to shn:Shewana3_1575)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVJ0 at UniProt or InterPro

Protein Sequence (578 amino acids)

>Shewana3_1575 Na+/solute symporter (RefSeq) (Shewanella sp. ANA-3)
MGVQGLTYLIVGLSFALYIGIAIWSRAGSTKEFYVAGGGVHPVVNGMATAADWMSAASFI
SLAGIVSFVGYDGSVYLMGWTGGYVLLALCMAPYLRKFGKFTVPDFVGERYYSQAARTVA
VICAIFICFTYIAGQMRGVGVVFSRFLEVDVDTGVYIGMAVVFFYAVLGGMKGITYTQVA
QYCVLIFAFMVPAIFLSVMMTGHIIPQIGFGAQLLDAAGNNSGVYLLEKLNNLSVDLGFA
PYTDGSKSMIDVFCITGALMVGTAGLPHVIVRFFTVPKVKDARVSAGWALVFIAIMYTTV
PALAAFSRVNMIETINGPDQKGVAYETAPDWIKNWEKTGLIKWDDKNGDGKIYYAKGKME
DAASPNEMKIDNDIIVLATPEIANLPAWVIALVAAGGLAAALSTSAGLLLVISTSVSHDL
LKKNLMPNISDKKELMYARLAAGIGIVIAGYFGVNPPGFVAAVVAFAFGLAASSLFPAII
MGIFSKTMNKEGAIAGMVIGLLFTAGYIIYFKFVDPTANVAANWFLGISPEGIGMVGMVV
NFAVAAIVCKVTAAAPAHVQDMVESIRFPKGAGEASSH