Protein Info for Shewana3_1570 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details PF11143: DUF2919" amino acids 7 to 152 (146 residues), 173 bits, see alignment E=2.6e-55

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1570)

Predicted SEED Role

"FIG01056753: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVI5 at UniProt or InterPro

Protein Sequence (164 amino acids)

>Shewana3_1570 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MRLNFSHITWLDDKGHIKPPIFLYAILAFLARGWCIFIASLTQASDRSELVRLFYPEKSD
FLLALAAGLGAVVLYVVVLAERRRSPSWLRPVFVQLKWGLWILLLLDATLLAQRLIHGQF
LFHWSLALDALVLFWSGLYVYKSKRLSYYLADWPKETVTSVKED