Protein Info for Shewana3_1560 in Shewanella sp. ANA-3

Annotation: methyltransferase type 12 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF21212: Dimerisation2-like_dom" amino acids 18 to 88 (71 residues), 59.1 bits, see alignment E=4.4e-20 PF00891: Methyltransf_2" amino acids 182 to 334 (153 residues), 58.9 bits, see alignment E=4.9e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1560)

Predicted SEED Role

"Putative O-methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVH5 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Shewana3_1560 methyltransferase type 12 (RefSeq) (Shewanella sp. ANA-3)
MSFYHTPKALSAFDAKFEAQKIAFGPISFQVAHCLLKFEVLATIDQAGEQGLSIAQLAQT
NVLNEYALGVLLDMGLSMGLVWLNGDAYVLDKTGYFLLHDDMAAINLNFVQDVCYQGLFQ
LDKALVAGKPSGLAVFGDWQTIYPALKDLPAEAKASWFAFDHYYSDHAFPQILPLVFAHS
PKHLVDIGGNTGKWALSCCEFNPEVEVTLMDFPGQLAVAKDNATKHGFAERIHTFATDLL
DESRPFVEGADTYWMSQFLDCFSQEQILSILQRTAQAMTPNSQLFIVETFWDRQPSAASA
YCVNATSLYFTAMANGNSRMYHSKDLIKLLHQAGLYVDEDTDNLGLGHTLLRCKRKP