Protein Info for Shewana3_1557 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 187 to 213 (27 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 415 to 432 (18 residues), see Phobius details amino acids 444 to 465 (22 residues), see Phobius details amino acids 469 to 489 (21 residues), see Phobius details amino acids 498 to 520 (23 residues), see Phobius details PF03606: DcuC" amino acids 31 to 517 (487 residues), 448.1 bits, see alignment E=1.6e-138

Best Hits

Swiss-Prot: 65% identical to YFCC_ECOLI: Putative basic amino acid antiporter YfcC (yfcC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1557)

Predicted SEED Role

"Putative S-transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVH2 at UniProt or InterPro

Protein Sequence (522 amino acids)

>Shewana3_1557 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MTTPPSTTQPTEAAQTAMAPSASHAPSSFQMPDTLVIIFFVALLAGLMTYFIPIGSFQTQ
EVHYLAEGVDKARTVVDPNSFAYQLDDAGEPKLQPVALFKGEGGVGFFNFAFEGLTSGSK
WGSAIGVIMFMLVIGGSFGVVMATGTIDNGILKLIDKTRGNEKLFIPVIFTLFSLGGAVF
GMGEEAIAFAIIICPLMIRLGYDGITTVMVTYVATQIGFASSWMNPFSVAIAQGIAGIPV
LSGSEFRFPMWLGFTLLGIVFTMRYAHRIQQQPSISHSYQSDAYFREHHANTKLESRFNL
GDVLVLLLLVLTMVWVIWGVVAKAWFIPEIASQFFTMGMVAGVIGCVFKLNGLTLNKVAQ
SFKDGAKTMLEPALLVGCASGILLLLGGGTPTEPSVLNSILNSAGGVIGHLPDALSAWFM
LLFQSVFNFFVTSGSGQAALTMPLMAPLSDIVGVTRQVAVLAFQLGDGLTNIIVPTSASL
MATLGVCRVDWGNWLKFVWRFMLLLMLVSSVLVIGAHYLGFN