Protein Info for Shewana3_1553 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 transmembrane" amino acids 58 to 76 (19 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details PF04217: DUF412" amino acids 24 to 163 (140 residues), 192.2 bits, see alignment E=2.1e-61

Best Hits

Swiss-Prot: 97% identical to Y2914_SHEON: UPF0208 membrane protein SO_2914 (SO_2914) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K09899, hypothetical protein (inferred from 99% identity to she:Shewmr4_1492)

Predicted SEED Role

"FIG01056706: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVG8 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Shewana3_1553 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MPDCAMVKAVFLCCRCLKLSINILKTLGDGRRYMKTWPMVRQLGLYFPEYRVVRATQLAI
LVMPVLAILASVSQIYTYGWAFLPQALTIALFFISLPLQGLLWLGWRARHPLPLSLFDWS
NQLSAKLSAMGIHCQSLGAKACYLDMALILKIAFERLDASYWEEL