Protein Info for Shewana3_1544 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 223 to 276 (54 residues), see Phobius details amino acids 290 to 320 (31 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 327 (313 residues), 215.4 bits, see alignment E=6.3e-68

Best Hits

Swiss-Prot: 48% identical to Y338_HAEIN: Putative transport protein HI_0338 (HI_0338) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1544)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVF9 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Shewana3_1544 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MTRSNTPSAAYKGFAVMAFVVIILAGIKAASPIVVPFVLSSFIAVICNPAIGLMTKYRVP
KWLAVILLMGFIVLMGLWLASLVGSSINEFSKQLPQYRDQLVEQFSWVLHKLQALNIQIS
KEQVLAYFDPGMALSMTTNMLSGVGNVMANLFLIILTIVFMLFEAQSLPKKLHLALDDPD
MRLQQIDRFLQSVNQYMVIKTLVSLATGLIVGVGLAVIGVDYALLWAVIAFLFNYIPNIG
SIIAAIPAVLLAFIQLGPAAAGGTALLYVAANMVMGNLVEPKFMGRGLGLSTLVVFLSLI
FWGWLLGSVGMLLSVPLTMVVKIALESSKSGSWLAILLSDDVDDKLVSQSTSTAPISEPV
DTHSTDNK