Protein Info for Shewana3_1542 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01777: TIGR01777 family protein" amino acids 3 to 290 (288 residues), 340.6 bits, see alignment E=4.8e-106 PF01370: Epimerase" amino acids 3 to 219 (217 residues), 76.5 bits, see alignment E=4.5e-25 PF08338: DUF1731" amino acids 247 to 293 (47 residues), 66.1 bits, see alignment 3.5e-22

Best Hits

Swiss-Prot: 50% identical to YFCH_ECOLI: Epimerase family protein YfcH (yfcH) from Escherichia coli (strain K12)

KEGG orthology group: K07071, (no description) (inferred from 100% identity to she:Shewmr4_1483)

Predicted SEED Role

"Cell division inhibitor Slr1223 (YfcH in EC), contains epimerase/dehydratase and DUF1731 domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVF7 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Shewana3_1542 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MKILITGASGFIGQQLVAHLANQHELVLLTRHPGTSRQLLGPQHQYLSTLDEVDDLNHID
AVINLAGEPIVAKRWSAQQKQRICDSRWNTTARLSQLILHSCTPPKVMISGSAIGFYGRQ
GAIPIDETAAPHPEFSHDICQEWERLAQQAATKTRVCILRTGIVLGHGGALAKMLPPFKL
GLGGPIGHGCQGMSWIHIQDMVALIDFLLNHDECEGIFNATAPNPVSNAEFATTLGRVLN
RPTFITTPAAMLRLAMGEMAELLIEGQFVLPKHALDAGFSFRFERLEPALRDVLAS