Protein Info for Shewana3_1534 in Shewanella sp. ANA-3

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 118 to 144 (27 residues), see Phobius details amino acids 156 to 182 (27 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 232 to 257 (26 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 324 to 344 (21 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details amino acids 392 to 409 (18 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 447 to 468 (22 residues), see Phobius details amino acids 490 to 510 (21 residues), see Phobius details amino acids 692 to 711 (20 residues), see Phobius details amino acids 737 to 757 (21 residues), see Phobius details amino acids 820 to 840 (21 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 8 to 293 (286 residues), 59.8 bits, see alignment E=3.3e-20 PF09924: LPG_synthase_C" amino acids 537 to 822 (286 residues), 303.3 bits, see alignment E=1.6e-94

Best Hits

KEGG orthology group: K14205, phosphatidylglycerol lysyltransferase [EC: 2.3.2.3] (inferred from 100% identity to shn:Shewana3_1534)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVE9 at UniProt or InterPro

Protein Sequence (850 amino acids)

>Shewana3_1534 hypothetical protein (RefSeq) (Shewanella sp. ANA-3)
MGRRIRVIISLLIFTVSLLLLYNLEQDYQLNDILAEVKLFSFSQLALAVALTVTSYLMLT
LYDYLAIKQLGSSLSYQKVAPVSFLAFTFSNTIGFSLLTGTSIRYKFYSELGLTGNQITQ
IVLACSVTFFLGFFFICGIALINFPAQQLADLPLPTWLFSLSRVFGVLMLLGVVGYFLFS
LLRKKPIYFRGFEFAPPVLSQSLKQFVVSTLDWLVVGTLFYSLLPAVDGLSYLQVLSIFF
VANAIGVLAHVPGGIGVFESVVTVTLSQYLPVEQILGSVIVYRVIYYIVPFMLALIYFVA
GLVLNNKDKLSKINIDLHIVRQLLPPLLSISVFSVGLVLLLSVVNPSIVHKYHWLGEIVP
LPIVELSSLILSASGILLLLLSHGLFKRYKKAFILTQKLLLVAIVFIVLKGAEWQISLAL
GLIYLLMLPCEQVFYRQGSIVGVKYSFGWLLSLAAALFLMVWVLFFAYQDVDYDHSLWLT
FSQDSHVSRALRGGAIALAILLGFAIRYVLAVRKPHTSRLDSSALSCAMEIVANAPSSHG
YLALVQDKSLLFNEDKDAFLMYARAGHCWVVMGDPIGNPDKFDDLLWQFRELCDAYDGWP
VFYQVTQKYLPHFLEQGLSLYKLGEEAIVSLAEFELQSSKYRSLRQSHAKALREGLSFKV
VDASEVQSLLPTLEAISTSWLKAKQGREKGFSVGYFSAAYLCATPMALVYLNGELVAFSN
VWASGAKMEFSVDLMRYLPNLSGSNIMDFLFTELLLWGKQQGYQQFNLGMAPMSGLTDRA
LVPFWTKLAKTVYKKGNKFYNFQGLRRYKDKFNPRWEAKYLICYGGLSLPVVVGSLVTLT
SRGATGVFKK