Protein Info for Shewana3_1524 in Shewanella sp. ANA-3

Annotation: condensin subunit ScpB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR00281: segregation and condensation protein B" amino acids 8 to 174 (167 residues), 121.4 bits, see alignment E=1.7e-39 PF04079: SMC_ScpB" amino acids 11 to 170 (160 residues), 177.2 bits, see alignment E=9.7e-57

Best Hits

Swiss-Prot: 38% identical to SCPB_CLOPS: Segregation and condensation protein B (scpB) from Clostridium perfringens (strain SM101 / Type A)

KEGG orthology group: K06024, segregation and condensation protein B (inferred from 100% identity to son:SO_3014)

Predicted SEED Role

"Segregation and condensation protein B" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVD9 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Shewana3_1524 condensin subunit ScpB (RefSeq) (Shewanella sp. ANA-3)
MQINPIQLKQLIEASLFVLGKPLSVKMLKETVLADFSVSRDKIKAALEELQQDYQERGVQ
LVKVAGGYRFQTLEVLSPFLQPLWQEKAPKYSRATLETLAVIAYRQPVTRGDIEQVRGVA
ISSHIIKSLSDRHWIKVVGHKEVPGRPALYATTLEFLAYFGLDTLADLPALTDTESLQAV
FSGLKVTPEQSEEQDTNE