Protein Info for Shewana3_1519 in Shewanella sp. ANA-3
Annotation: anthranilate synthase component II (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 56% identical to TRPG_VIBPA: Anthranilate synthase component 2 (trpG) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
KEGG orthology group: K01658, anthranilate synthase component II [EC: 4.1.3.27] (inferred from 100% identity to shn:Shewana3_1519)MetaCyc: 47% identical to anthranilate synthase beta subunit (Pseudomonas aeruginosa PAO1)
Anthranilate synthase. [EC: 4.1.3.27]
Predicted SEED Role
"Anthranilate synthase, amidotransferase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)
MetaCyc Pathways
- superpathway of chorismate metabolism (51/59 steps found)
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of L-tryptophan biosynthesis (13/13 steps found)
- L-tryptophan biosynthesis (6/6 steps found)
- superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
- L-citrulline biosynthesis (7/8 steps found)
- L-glutamate and L-glutamine biosynthesis (6/7 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
- 4-aminobenzoate biosynthesis I (2/2 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- superpathway of L-citrulline metabolism (9/12 steps found)
- L-glutamine degradation I (1/1 steps found)
- 4-hydroxy-2(1H)-quinolone biosynthesis (2/5 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
- acridone alkaloid biosynthesis (1/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (1/4 steps found)
- superpathway of quinolone and alkylquinolone biosynthesis (2/10 steps found)
- chloramphenicol biosynthesis (1/9 steps found)
- superpathway of candicidin biosynthesis (2/11 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Phenylalanine, tyrosine and tryptophan biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.1.3.27
Use Curated BLAST to search for 4.1.3.27
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0KVD4 at UniProt or InterPro
Protein Sequence (202 amino acids)
>Shewana3_1519 anthranilate synthase component II (RefSeq) (Shewanella sp. ANA-3) MKLYLLDNFDSFTYNLVDQFRSLGCEVVIYRNDVAADYIANKLLAETEPSALVLSPGPGA PHEAGSMMSLIDKVAGKVPMLGICLGHQAMVEYYGGKVERAPFVVHGKASPTFHNGTGVF ANLPSPLPVARYHSLVATKVPDCLEVIATTEEMPMAILHAEHRAVGFQFHPESILTTLGS TLLTQTLRFLTQDIVHNTAGAQ