Protein Info for Shewana3_1518 in Shewanella sp. ANA-3

Name: trpD
Annotation: anthranilate phosphoribosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF02885: Glycos_trans_3N" amino acids 8 to 69 (62 residues), 61.2 bits, see alignment E=6.4e-21 TIGR01245: anthranilate phosphoribosyltransferase" amino acids 15 to 340 (326 residues), 427.2 bits, see alignment E=2.3e-132 PF00591: Glycos_transf_3" amino acids 81 to 331 (251 residues), 341 bits, see alignment E=5.2e-106

Best Hits

Swiss-Prot: 100% identical to TRPD_SHESA: Anthranilate phosphoribosyltransferase (trpD) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 100% identity to shn:Shewana3_1518)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVD3 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Shewana3_1518 anthranilate phosphoribosyltransferase (RefSeq) (Shewanella sp. ANA-3)
MSATSIQPLLDILFLGKALTREQTASLFSTLIQGEMNEAVMAAMLMALKIRGETIAEISG
AADAMRAAAKPFPYPASSRSQGIIDIVGTGGDGFNTINISTTAAFVAAAAGAKVAKHGNR
SVSSKSGSSDLLAQFGIDLTMSPELASRCLESLNLCFLFAPHYHGGVKHAVPVRQALKTR
TLFNVLGPLINPARPEFMLLGVYSPELVTPIARVLQALGTQRAMVVHGSGLDEVALHGST
QVAELKDGEIIEYQLTPADFGVPQAQISELEGGEPAQNAQITQSILQGQGSDAHTHAVAI
NAGCALYLCGLSDSVKAGTALALNTIKSGKAFELLNQLAKVSSEAQE