Protein Info for Shewana3_1505 in Shewanella sp. ANA-3

Annotation: intracellular septation protein A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 51 to 68 (18 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details PF04279: IspA" amino acids 1 to 174 (174 residues), 234.4 bits, see alignment E=5e-74 TIGR00997: intracellular septation protein A" amino acids 1 to 176 (176 residues), 213 bits, see alignment E=1.8e-67

Best Hits

Swiss-Prot: 100% identical to YCIB_SHESA: Probable intracellular septation protein A (Shewana3_1505) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K06190, intracellular septation protein (inferred from 98% identity to son:SO_3035)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVC0 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Shewana3_1505 intracellular septation protein A (RefSeq) (Shewanella sp. ANA-3)
MKQLLDFLPLIIFFAVYKFFDIYIASGALIAATALQLVVTYALYKKLEKMHLITFAMVTV
FGTLTLVFHDDAFIKWKVTIIYALFALALGVSQLLNKSILKSMLGKEMKVADKIWAHVTW
YWVSFFAICGLVNIYVAFRLPLETWVNFKVFGLTALTLINTVITVFYLYKHLPEDQRKEL
K