Protein Info for Shewana3_1501 in Shewanella sp. ANA-3

Annotation: GCN5-related N-acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF13302: Acetyltransf_3" amino acids 10 to 149 (140 residues), 124.3 bits, see alignment E=9e-40 PF13420: Acetyltransf_4" amino acids 13 to 158 (146 residues), 34.9 bits, see alignment E=2.3e-12 PF00583: Acetyltransf_1" amino acids 59 to 149 (91 residues), 52.4 bits, see alignment E=9.1e-18

Best Hits

Swiss-Prot: 35% identical to YOAA_BACSU: Uncharacterized N-acetyltransferase YoaA (yoaA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00676, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to shn:Shewana3_1501)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KVB6 at UniProt or InterPro

Protein Sequence (180 amino acids)

>Shewana3_1501 GCN5-related N-acetyltransferase (RefSeq) (Shewanella sp. ANA-3)
MLGIKIETERLVLRAFNEDDSKALFDIFSDPEVMKYWNTPPWRSLDDAAAFINNSSDSMC
DFRGMTLGVYKKHSGELLGKVMLFNYDKESKRAEIGFGISPKYWGKGIVSEAGTALIKFA
FNTLGLRRIEAEIDPENVSSAKVLERMGFIKEGHLRQRWEVSSVISDSALYGLLAEDLRA