Protein Info for Shewana3_1476 in Shewanella sp. ANA-3

Annotation: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic region (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF00389: 2-Hacid_dh" amino acids 30 to 146 (117 residues), 73.5 bits, see alignment E=2.1e-24 PF02826: 2-Hacid_dh_C" amino acids 113 to 257 (145 residues), 108.1 bits, see alignment E=5.3e-35 PF11890: DUF3410" amino acids 290 to 370 (81 residues), 87.5 bits, see alignment E=6.7e-29

Best Hits

Swiss-Prot: 100% identical to PDXB_SHESA: Erythronate-4-phosphate dehydrogenase (pdxB) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K03473, erythronate-4-phosphate dehydrogenase [EC: 1.1.1.290] (inferred from 100% identity to shn:Shewana3_1476)

Predicted SEED Role

"Erythronate-4-phosphate dehydrogenase (EC 1.1.1.290)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.290)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.290

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV91 at UniProt or InterPro

Protein Sequence (376 amino acids)

>Shewana3_1476 D-isomer specific 2-hydroxyacid dehydrogenase, catalytic region (RefSeq) (Shewanella sp. ANA-3)
MKIVVDENMPYVEPLFGALGEIIPVNGRTLTPEQVQDADVLLVRSVTRVNAALLDANSKL
KFVGSATIGTDHVDLAYLAGRGIPFSNAPGCNATAVGEFAFIAMLELAARFNSPLKGKVV
GIVGAGNTGSATAKCLEAYGIKVLLNDPIKAAEGDPRHFVSLETLLHEADIISLHVPITR
TGEHKTLHLFDEARMMSLKPNTWLLNCCRGDVIDNQALIKVKEQRDDLKLVLDVWEGEPN
PMPELVPFAEFATPHIAGYSLEGKARGTFMLYQKLCELLAIPATKRLSELLPPFHFKAVE
LEQAPDEKALLQLARFVYDLRDDDAVFRNGFARSNGFDTMRKNHKHRREFSALALAYHGQ
SEVDWLSNLGFSGVGR