Protein Info for Shewana3_1470 in Shewanella sp. ANA-3

Annotation: major facilitator transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details PF12832: MFS_1_like" amino acids 12 to 363 (352 residues), 364.6 bits, see alignment E=9.8e-113 PF07690: MFS_1" amino acids 15 to 278 (264 residues), 49.4 bits, see alignment E=4.8e-17 amino acids 256 to 386 (131 residues), 35.5 bits, see alignment E=8.6e-13 PF03825: Nuc_H_symport" amino acids 18 to 379 (362 residues), 62.4 bits, see alignment E=6.3e-21

Best Hits

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 100% identity to shn:Shewana3_1470)

Predicted SEED Role

"Nucleoside:H+ symporter:Major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV85 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Shewana3_1470 major facilitator transporter (RefSeq) (Shewanella sp. ANA-3)
MPTISSTSQQLRWLCACYFFFFSILGTMIPYLGVFFENRGFNPQEIGFLLAILMATRIVA
PNVWAKVADRTGMRSELVKMGAGAAMLAYLSFFYHGGFVYMALSLALYTFFWNAILAQLE
VITLETLGENASRYGQIRSFGSIGYICLVVGAGFAIGQWGTEVLPYIGLALFTGMLVSAL
PLPANRAVRPQGQERQPLKWTKPILWFMVSAMLLQMSAGPFYGFFVLYLKQAGYTEAAAG
IFVAFGAMAEIVMFMFAPRLLGRYGVNTLLVVSIAMTAVRWLLVAFGVESMLLLGLSQVL
HAFTFGLTHAASIQFVHRHFDASHRSQGQALYASLSFGVGGALGTWICGYIWGDGSGAVW
SWVFAAACAFAAMLAVFLIPKDRAQAVAA