Protein Info for Shewana3_1456 in Shewanella sp. ANA-3

Annotation: von Willebrand factor, type A (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 298 to 320 (23 residues), see Phobius details PF01882: DUF58" amino acids 84 to 219 (136 residues), 24.5 bits, see alignment E=3.1e-09 PF00092: VWA" amino acids 85 to 277 (193 residues), 80.2 bits, see alignment E=4.6e-26 PF13519: VWA_2" amino acids 86 to 197 (112 residues), 61.8 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to shn:Shewana3_1456)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV71 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Shewana3_1456 von Willebrand factor, type A (RefSeq) (Shewanella sp. ANA-3)
MLTVAWPLALILLPLPFIFWRRQTVQAEGGRLQLPGISQTDKANITSHSRQSRKRYWLMW
SLLVLAIARPQWLGDPIELPSQGRDLMLAVDLSGSMQIEDMVINGKVVDRFTLIQHVVSE
FIERRKGDRIGLILFADHAYLQAPLTQDRRSVAQFLKEAQIGLVGKQTAIGESIALAVKR
FDKMDESNRVLILLTDGSNNAGNIEPEQAAQIAANRKVTIYTVGVGADVMERRTLFGRER
VNPSMDLDENQLKHIADVTHGRYFRARNSQELEQIYQEIDKLEPVSRDQLSYRPQAELFY
WPLALALLTSIWIALGQLSLFSRTKNPVPSATPRGDVR