Protein Info for Shewana3_1451 in Shewanella sp. ANA-3

Annotation: sodium/proline symporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 46 to 70 (25 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 188 to 208 (21 residues), see Phobius details amino acids 226 to 246 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 315 to 341 (27 residues), see Phobius details amino acids 364 to 382 (19 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details amino acids 420 to 438 (19 residues), see Phobius details amino acids 444 to 462 (19 residues), see Phobius details TIGR02121: sodium/proline symporter" amino acids 6 to 481 (476 residues), 678.9 bits, see alignment E=4.2e-208 TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 35 to 428 (394 residues), 321.5 bits, see alignment E=9.2e-100 PF00474: SSF" amino acids 35 to 428 (394 residues), 355.3 bits, see alignment E=2.2e-110

Best Hits

Swiss-Prot: 51% identical to PUTP_BACSU: High-affinity proline transporter PutP (putP) from Bacillus subtilis (strain 168)

KEGG orthology group: K11928, sodium/proline symporter (inferred from 100% identity to shn:Shewana3_1451)

Predicted SEED Role

"Proline/sodium symporter PutP (TC 2.A.21.2.1) @ Propionate/sodium symporter" (TC 2.A.21.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV66 at UniProt or InterPro

Protein Sequence (483 amino acids)

>Shewana3_1451 sodium/proline symporter (RefSeq) (Shewanella sp. ANA-3)
MTIETPILITFVGYLVLMMGIGFWAYRATDTVDDYILGGRKMGPAVTALSVGASDMSGWL
LLGLPGAVYLGGLGEAWIGIGLVVGAWLNWLFVAKRLRIYTQLADNALTLPDFFEKRFHD
KQGYLKLVSAVTILVFFTFYASSGMVGGAILFEKVFGLDYTVALVIGSAIIVGYTFIGGF
FAVSWTDFFQGCLMLIALLIIPFAVFSHPESHAGIESIDPAMLALISDKTTVIGLLSLLA
WGLGYFGQPHILSRFMAIGTADALPLSRRIAMSWMMLSLIGALATGLAGSLYFANQPLAN
AETVFIHLAQAAFNPWIGGLLIAAILSAIMSTIDSQLLVCSSVITEDFYRKWLRPQADDR
ELMMVGRMGVLAIAVIAGIIALNPESSVLSLVSYAWAGFGAAFGPVVLLSLFWKQYSRNG
AIATIIVGALTVVIWKQLTGGIFDLYEILPGFVFAIIAGVVVSKMSRPAETITAEFEQFK
SAL