Protein Info for Shewana3_1443 in Shewanella sp. ANA-3

Annotation: peptidase S8 and S53, subtilisin, kexin, sedolisin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 809 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05922: Inhibitor_I9" amino acids 47 to 138 (92 residues), 38.4 bits, see alignment E=4.2e-13 PF00082: Peptidase_S8" amino acids 164 to 555 (392 residues), 138.5 bits, see alignment E=7.4e-44 PF02225: PA" amino acids 393 to 482 (90 residues), 30.2 bits, see alignment E=1e-10 PF04151: PPC" amino acids 604 to 671 (68 residues), 68.7 bits, see alignment E=1.7e-22 PF01483: P_proprotein" amino acids 729 to 808 (80 residues), 79.2 bits, see alignment E=5.1e-26

Best Hits

KEGG orthology group: K14645, serine protease [EC: 3.4.21.-] (inferred from 100% identity to shn:Shewana3_1443)

Predicted SEED Role

"Alkaline serine protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV58 at UniProt or InterPro

Protein Sequence (809 amino acids)

>Shewana3_1443 peptidase S8 and S53, subtilisin, kexin, sedolisin (RefSeq) (Shewanella sp. ANA-3)
MTINRTTKIALSLSSLAIAISAGVNAAPDAPGFAAAKQAQTSPLPKRYIVKFKNADAPAL
MSESSLQSSDQLATTMNYQPQVAEISAQHSVLNKAQAKEMKRIGRSNSYSVKLDNNGIKA
LRARADVEYVEEDMPRHLLSETTPWGQTFVGATQLSDSQAGNRTICIIDSGYDRGHSDLS
GNNVTGTNNSGTGNWYEPGNNNAHGTHVAGTIAAIANNDGVIGVMPNQNANIHVIKVFNE
AGWGYSSSLVSAVDTCVANGANVVTMSLGGAGSSTTERNALAAHYNNGVLLIAAAGNDGN
NTHSYPASYDAVMSVASVDNHKDHSAFSQYTNQVEISGPGEAILSTVTRGEGRLADITIG
GQSYFNSGVVPHNRFTPSGTNYAPNPYNGTATATLAECTVSGSTFNCGNMANKVCLVERV
GNQGTSYPEINAVKACKNAGASAVIVYSNSALPGLQNPFLVDANSEINMVSVSVDRATGL
ALRNQLGATVTVSNQGNKDYEYYNGTSMATPHVSGVATLVWSYHPECSAAQVRNALKQTA
EDLGTAGRDDYYGYGLVNAVAAKTFLDASCNGPTDPVDPTPTDSVLVNGVPKTGLSGAAS
EELHFSFEVPQGATNLGFVMNGGTGDADLYVQYGAAPTTSNYDCRPYKGGNSESCPISNV
QSGTYYAMVKGYSAFSGVSLTASYTAQSGGGTPTTPASYTNADNYNIPDNKTAGITSPIT
VTRTGNSGTVTAVVNIVHPYIGDLKVQLISPTGQTATLHNNTGAGADNINKSYTVDMTGV
ESSGVWKLKAVDSGRGDVGYIDSWELKFQ