Protein Info for Shewana3_1437 in Shewanella sp. ANA-3

Name: secD
Annotation: preprotein translocase subunit SecD (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 454 to 473 (20 residues), see Phobius details amino acids 479 to 501 (23 residues), see Phobius details amino acids 507 to 526 (20 residues), see Phobius details amino acids 547 to 572 (26 residues), see Phobius details amino acids 579 to 602 (24 residues), see Phobius details PF13721: SecD-TM1" amino acids 2 to 103 (102 residues), 117.1 bits, see alignment E=1.4e-37 PF07549: Sec_GG" amino acids 115 to 139 (25 residues), 26.7 bits, see alignment (E = 9e-10) TIGR01129: protein-export membrane protein SecD" amino acids 123 to 602 (480 residues), 491.4 bits, see alignment E=2.3e-151 PF21760: SecD_1st" amino acids 229 to 288 (60 residues), 100.4 bits, see alignment 8.9e-33 PF22599: SecDF_P1_head" amino acids 305 to 432 (128 residues), 113.3 bits, see alignment E=1.8e-36 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 347 to 595 (249 residues), 258.5 bits, see alignment E=5.7e-81 PF02355: SecD_SecF_C" amino acids 435 to 601 (167 residues), 68.4 bits, see alignment E=1.7e-22 PF03176: MMPL" amino acids 457 to 595 (139 residues), 32.1 bits, see alignment E=1.9e-11

Best Hits

Swiss-Prot: 62% identical to SECD_VIBAL: Protein translocase subunit SecD (secD) from Vibrio alginolyticus

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 100% identity to shm:Shewmr7_1449)

MetaCyc: 59% identical to Sec translocon accessory complex subunit SecD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV52 at UniProt or InterPro

Protein Sequence (616 amino acids)

>Shewana3_1437 preprotein translocase subunit SecD (RefSeq) (Shewanella sp. ANA-3)
MLNKYPMWKNIMVVLVIAIGCFYAVPNLFGEDHAVQVVATRGAEVTASTQARVNELLASK
GIAVKRSELEKGQLLVRVQNADQQLLAKETIAEDLGDKFTVALNLAPATPQWLESMGGSP
MKLGLDLRGGVHFLMEVDMGEAIRKMEEAKVADFRSQLREEKIRYAGIRNNAQGIEIKFR
DAESLASAERFLKSRSNDMVFSDVSKGEDFALQAVMSETYLKQIKEEALQQNITTIRNRV
NELGVAEPVVQRQGAERIIVELPGVQDTARAKEILGATASIEFHMVDDKADPNAAQSGRV
PAGSEVYQRREGGQVVLKKEVMLTGDHITGAQPSFDQYSRPQVSINLDAKGGTIFSNVTK
DNIGKPMATLFIEYKDSGERNADGSVKMQKIQEVISVATIQARLGRNFVITGLSHGEAQN
LALLLRAGALIAPVSIVEERTIGPSLGAENIESGVQAMIWGMAVVLIFMLVYYRSFGLIA
NLALTANLVMVVGVMSMIPGAVLTLPGIAGMVLTVGMAVDGNVLIYERIREELRAGRSVQ
QAIHEGYGNAFSTIADANITTFLTALILFAVGTGAIKGFAVTLMIGIATSMFTAIVGTRA
IVNAIWGGKRVKTLSI