Protein Info for Shewana3_1430 in Shewanella sp. ANA-3

Annotation: pseudouridine synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00849: PseudoU_synth_2" amino acids 22 to 171 (150 residues), 120.9 bits, see alignment E=2.9e-39

Best Hits

KEGG orthology group: K06177, ribosomal large subunit pseudouridine synthase A [EC: 5.4.99.12] (inferred from 100% identity to shn:Shewana3_1430)

Predicted SEED Role

"Similar to ribosomal large subunit pseudouridine synthase A, group 2" in subsystem Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 5.4.99.12

Use Curated BLAST to search for 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV45 at UniProt or InterPro

Protein Sequence (223 amino acids)

>Shewana3_1430 pseudouridine synthase (RefSeq) (Shewanella sp. ANA-3)
MQIFDYQPPSVPWLDLRYQDRDLIIINKPSGLLSNPGRAAHTFDCALTRLQRLYPDTILV
HRLDCATSGIMVFARNKKAESQLKTQFQDRQNEKVYIAEVMGGIAKDAGIIDLAIAPDPE
HPPYQKTQTPGTAGAKSALTHYRVLERRENSTLVELTPQTGRTHQLRVHMLALGHPILGD
EFYGDDEVIKARPRLCLHAQSLRFTHPYSGKAMHFYSKHPFSA