Protein Info for Shewana3_1426 in Shewanella sp. ANA-3

Annotation: serine/threonine transporter SstT (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 324 to 350 (27 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details PF00375: SDF" amino acids 16 to 396 (381 residues), 222.6 bits, see alignment E=4.4e-70

Best Hits

Swiss-Prot: 100% identical to SSTT_SHESA: Serine/threonine transporter SstT (sstT) from Shewanella sp. (strain ANA-3)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 99% identity to she:Shewmr4_1373)

MetaCyc: 66% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium/dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV41 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Shewana3_1426 serine/threonine transporter SstT (RefSeq) (Shewanella sp. ANA-3)
MKQESSLLAKLANGSLVLQILVGIIAGVSLASFSHEAAKQVAFLGSLFVGALKAIAPILV
FILVASSIANQKKNTQTNMRPIVVLYLFGTFAAALTAVVLSMMFPTNLVLVAGVEGTSPP
QGIGEVINTLLFKLVDNPVNALMTGNYIGILAWGVGLGLALHHASDSTKQVFADVSHGIS
QMVRFIIRLAPIGIFGLVAATFAETGFAAIAGYAKLLAVLLGAMAIIALIVNPLIVYVKI
KRNPYPLVIRCLRESGVTAFFTRSSAANIPVNMALCEKLKLHEDTYSVSIPLGATINMGG
AAITITVLTLAAAHTLGIQVDLLTALLLSVVAAISACGASGVAGGSLLLIPLACSLFGIS
NDVAMQVVAVGFIIGVIQDAAETALNSSTDVIFTAAACEAAENKAKLG