Protein Info for Shewana3_1424 in Shewanella sp. ANA-3

Annotation: phospholipase D/transphosphatidylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 39 to 57 (19 residues), see Phobius details PF13091: PLDc_2" amino acids 114 to 261 (148 residues), 43.7 bits, see alignment E=2.5e-15 amino acids 352 to 490 (139 residues), 80.1 bits, see alignment E=1.3e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to shn:Shewana3_1424)

Predicted SEED Role

"Cardiolipin synthetase (EC 2.7.8.-)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV39 at UniProt or InterPro

Protein Sequence (544 amino acids)

>Shewana3_1424 phospholipase D/transphosphatidylase (RefSeq) (Shewanella sp. ANA-3)
MTILGISSRNCGATFANTIAQHLAKEIGQQRKSYPVKQMVFRLSLPFWGLLLLLINGCSS
MAELPAKSIETAYPLAENSTLYQAVKTAIAQHSEQTGVFPLGDGVDAFVARLLLIESAVS
SIDLQYYIYRNDETGRLLTWFLLDAADRGVRVRLLLDDMTSADMDEQLIALARHPNINIR
LFNPSTERNYRGLAMLFGFSRLNHRMHNKSFTVDNVMTIVGGRNIGDEYFAANRDLEFGD
FDLLAMGDAVPKVSDEFDRYWNADTTHPIEVLSDHNPTHAELEALAQRVSEQREQSKSSE
YVKRLAESQLLANLQSDSMTWFWGKALVLVDPPDKLQQGDKSTWLLSQLLPYLTQVESEL
LIISPYFVPTQSGTDLLTLLAQSGKRVRVITNSLAATDVLAVHAGYKQYRKTLLAAGVEI
YEVKAQAGERSHSWHGSSKSSLHAKSFVFDNNQIFVGSFNFDPRSAAVNTELGLLITQPQ
LSGHVSHNIEEKLATNTYRLALEDGDLVWWDDGAQQRYDSEPDAGFWRIFVADFLGLLPI
ESQL