Protein Info for Shewana3_1423 in Shewanella sp. ANA-3

Annotation: Dual specificity protein phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 156 PF00782: DSPc" amino acids 27 to 136 (110 residues), 41.9 bits, see alignment E=8.7e-15 PF13350: Y_phosphatase3" amino acids 83 to 121 (39 residues), 34.1 bits, see alignment E=3e-12

Best Hits

KEGG orthology group: None (inferred from 94% identity to son:SO_3124)

Predicted SEED Role

"Protein tyrosine phosphatase (EC 3.1.3.48)" (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV38 at UniProt or InterPro

Protein Sequence (156 amino acids)

>Shewana3_1423 Dual specificity protein phosphatase (RefSeq) (Shewanella sp. ANA-3)
MQHLFWLVEGKIAGRSGPNKDPWDLAELKSLGIRAVLSVNGGEGCEPGSFKHHGLRYECI
PFSRNVPPQEGDVAICVAQLPRALAFIQQCEADNLPVLIHCRSGKDRTGLIMAYYLMVNG
AAPLHAVSQVRSIRDIAFTAEGWDQFAFDVLYALQE