Protein Info for Shewana3_1420 in Shewanella sp. ANA-3

Annotation: transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase / DNA-3-methyladenine glycosylase II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 PF02805: Ada_Zn_binding" amino acids 33 to 96 (64 residues), 92.9 bits, see alignment E=1.9e-30 PF00165: HTH_AraC" amino acids 127 to 160 (34 residues), 28.5 bits, see alignment (E = 2.7e-10) amino acids 173 to 212 (40 residues), 32.9 bits, see alignment 1.1e-11 PF12833: HTH_18" amino acids 134 to 212 (79 residues), 75.3 bits, see alignment E=7.9e-25 PF06029: AlkA_N" amino acids 245 to 372 (128 residues), 99.4 bits, see alignment E=3.4e-32

Best Hits

KEGG orthology group: K13529, AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 100% identity to shn:Shewana3_1420)

Predicted SEED Role

"Ada regulatory protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0KV35 at UniProt or InterPro

Protein Sequence (542 amino acids)

>Shewana3_1420 transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase / DNA-3-methyladenine glycosylase II (RefSeq) (Shewanella sp. ANA-3)
MKQTSVSQNSAPQPPSEPTSSDAQDCQISAGICREARMSRDPRFDGKFFVGVLSTGIYCR
TVCPAVAPKEENVRYFDSAIKAAQAGLRPCLRCRPDSAPGSNPWKGTNTTLDRAIGLIEA
GALSGEHGLTVEALADKLGISSRYLNKLFTAGFGTSPKQFALYRQLLFAKQLLHQTQLPI
TQVALAAGFNSIRRFNEAFQQALQLTPTQLRKSSQKSTIKIDDGESTELACSQEMPAHSL
SLYQYYRPPLDWSAQLAFYRLRAVEGMEWFSESVAPHFHEAIDPNIPLEYGRTLQIEDIR
AVVHIVHEAPLHRFKITLTLTPDSPLSGLQKLITQVRRILDLDADMQKIEHNLQHLTDLK
LSSKSGLRIPGAGAVFEAGCRAVLGQQVSVVQATKLLNILVEAYGECFSLNGREYRLFPT
PQAIRDASLDELKMPGARKLALNALAAFICEQPEASVDEWIGVKGIGPWTIAYAKLRGLG
DPNIFLHTDLIVKKQLLACVAEQSGLDIETVKQLDYTALAQRVSADIAPWGSYLTFQLWS
NA